HORDB

ID: hor006125
Uniprot ID: P18145
Protein name: C-type natriuretic peptide
Gene name: cnp
Organism: Anguilla japonica (Japanese eel)
Family: Natriuretic peptide family
Source: animal
Expression: Expression is generally higher in freshwater eels than in saltwater ones, except in brain, where the levels are the same. |Highly expressed in brain and liver, and moderately in gut, gills and heart. Expressed to a low level in atrium, ventricle and liver
Disease: NA
Comments: NA
Taxonomy: Anguilla (genus), Anguillidae (family), Anguilliformes (order), Elopomorpha , Elopocephala , Elopocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: GWNRGCFGLKLDRIGSLSGLGC
Length: 22
Propeptide: MMCKALVFAVLLLAVPLERADSRALRTPVDAIQFVEQFLEHYNDLLNIDDLENQTGDQLESPQPLSSGLKVAEYPKWVDVPSQNDNTWFRLLRGALANRKRALPDRAKRGWNRGCFGLKLDRIGSLSGLGC
Signal peptide: MMCKALVFAVLLLAVPLERA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. May be important for freshwater adaptation.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006125_AF2.pdb

hor006125_ESM.pdb

Mass:	268446	Formula:	C100H161N31O28S2
Absent amino acids:	AEHMPQTVY	Common amino acids:	G
pI:	8.83	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	7
Hydrophobicity:	12.27	Boman Index:	-1944
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	88.64
Instability Index:	575.91	Extinction Coefficient cystines:	5625
Absorbance 280nm:	267.86

PubMed ID: 11353677
Title: Enhanced expression and release of C-type natriuretic peptide in freshwater eels.
PubMed ID: 2143379
Title: Amino acid sequence and relative biological activity of a natriuretic peptide isolated from eel brain.